Everything below concerns lyophilisation. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-06-05. Numbers and descriptions here follow the published literature rather than marketing material.
Stability of the complex in solution depends on pH, temperature, and the presence of competing ligands. It is generally described as more resistant to breakdown than the metal-free chain, since coordination reduces susceptibility to enzymatic attack. Oxidation and hydrolysis can nevertheless proceed over time in aqueous media. Storage guidance in laboratory settings commonly involves refrigeration, protection from light, and avoidance of strongly alkaline conditions. Published data on long-term behaviour vary considerably and depend on the specific matrix.
Handling practices for the solid material emphasise low temperature and dryness. The lyophilised or powdered form is typically kept at refrigerator or freezer temperatures together with a desiccant. Working solutions are often prepared fresh, because repeated freeze-thaw cycles and extended storage may alter the complex. Glass or inert plastic containers are preferred over materials that could leach metal ions into the preparation. Such practices follow general peptide conventions rather than substance-specific regulations.
GHK-Cu is a coordination complex formed between the peptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The unbound chain, abbreviated GHK, consists of three amino acids and occurs naturally in human plasma, saliva, and urine. Binding of the metal is mediated mainly by the imidazole nitrogen of the histidine residue together with backbone amides, producing a stable chelate. Ingredient nomenclature often lists the same substance as copper tripeptide-1. Its charge and solubility behaviour differ from those of the metal-free chain.
The copper-binding activity of this sequence was described in the 1970s during studies of liver tissue and plasma factors. Early work identified the peptide as a component that influenced copper uptake by cells and that appeared in wound fluid. Later investigations examined its presence across species, reporting the same chain in human and animal samples. A decline in measured concentration with age became a recurring observation, although the underlying causes remain incompletely characterised.
| Property | Value | Notes |
|---|---|---|
| Appearance | Blue crystalline solid | Colour arises from copper(II) d-d transitions |
| Water solubility | Readily soluble | Extent varies with pH and counterion |
| Typical storage | Minus 20 degrees Celsius, desiccated | Protect from light and moisture |
| Purity method | Reverse-phase HPLC, UV detection | Wavelength typically 214 or 220 nanometres |
| Identity method | Mass spectrometry | Confirms peptide mass and copper content |
Dry material is normally held cold, commonly at -20 °C for long-term storage and 2 to 8 °C for working quantities, protected from light and moisture. Vials should be allowed to reach room temperature before opening so that condensation does not form on the powder. In liquid formulations the complex is generally kept near neutral to slightly acidic pH, because strongly alkaline conditions favour precipitation of copper hydroxide. Antioxidants or chelate-stabilising excipients are often added, though the specific approaches are proprietary and rarely published in detail.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography with ultraviolet detection, often paired with mass spectrometry to confirm the expected mass. Copper content is measured separately by inductively coupled plasma optical emission spectrometry or atomic absorption spectroscopy, because the peptide assay alone does not establish the metal-to-peptide ratio. Visible spectroscopy provides a rapid check on complex integrity through the absorption band in the visible region. Agreement between the peptide assay and the copper assay is the practical test of whether a sample is the intended complex rather than a mixture.
The International Nomenclature of Cosmetic Ingredients lists the substance as copper tripeptide-1, the name that appears on most topical product labels. Related designations include copper peptide and GHK-Cu, and the hyphenated form is common in research literature. In cosmetics the material is regulated as an ingredient rather than as a drug, so products may reach the market without evidence of the effects claimed for them. Whether those effects are clinically meaningful is an open question, since most supportive data come from laboratory work and small trials.
GHK-Cu is the copper complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence found naturally in human plasma, saliva and urine. Loren Pickart reported the isolation of the free peptide in 1973 while studying factors that influenced the growth of aged liver cells in culture. The peptide was later shown to bind copper(II) with high affinity, and the metal-bound form became the focus of most subsequent research. Its concentration in circulation declines markedly with age, a pattern that is well documented, though the physiological consequences of that decline remain debated.
The peptide portion consists of three amino acids: glycine, histidine and lysine. Copper(II) coordinates through the imidazole nitrogen of histidine, the alpha-amino group of glycine and a deprotonated amide nitrogen of the backbone, producing a roughly square-planar geometry. This arrangement gives the complex its characteristic blue-to-violet colour and helps it resist dissociation in water. Reported stability constants are high, although values differ between studies because of differences in ionic strength and measurement method.
== Treatment == There is no cure for Schwartz–Jampel syndrome. Treatment is aimed at reducing muscle stiffness and cramping and may include massage, muscle warming and gradual strengthening exercises. Muscle relaxants or anti-seizure medications, especially carbamazepine, may be used. Eye symptoms such as blepharospasm might be relieved by Botox. Otherwise, a variety of surgical procedures have been found to be effective. Malignant hyperthermia, a potential complication of surgery, is a greater risk for people Schwartz–Jampel syndrome and an important consideration when considering surgery.
The fund bought the remaining 80% of Truist, together with Stone Point Capital, Clayton, Dubilier & Rice and other investors, for $15.5 billion in 2024. In May 2023, Mubadala agreed to buy a majority stake in a New York–based Fortress Investment Group from the SoftBank Group. The $3 billion takeover was intended to be closed in the first quarter of 2024. However, the deal that would give Mubadala 70% stakes in Fortress was being scrutinized by the U.S. national security officers. The deal, which raised concerns for the US over the UAE's ties with China, was being closely reviewed by the Committee on Foreign Investment in the US (Cfius). In May 2024, the regulatory body approved of the sale. A year later in April 2025, Mubadala and Fortress Investment started a $1 billion investment partnership. Mubadala increased its partnership with Aldar Properties in September 2024 with four joint ventures amounting to more than $8.2 billion across Abu Dhabi. In September 2024, Turkish Competition Authority confirmed that Mubadala applied to acquire Getir in entirety. In June 2024, Getir founders, Nazim Salur and Serkan Borancili, opposed Mubadala's restructuring plan that would separate profitable local grocery delivery operations with noncore businesses. Under the proposed plan, Mubadala was to acquire grocery delivery operations in exchange for $250 million investment. However, in January 2025, Salur alleged Mubadala of an “illegal coup” and vowed to take legal action against the Emirati firm.
The Gunditjmara, a local Aboriginal Australian people in south-western Victoria, Australia, may have raised short-finned eels as early as about 4,580 BCE. Evidence indicates they developed about 100 km2 (39 sq mi) of volcanic floodplains in the vicinity of Lake Condah into a complex of channels and dams, and used woven traps to capture eels, and to preserve them to eat all year round. The local Budj Bim Cultural Landscape, a World Heritage Site, is one of the oldest known aquaculture sites in the world. Anthropologist Peter Sutton has disputed that these eel trapping systems qualify as aquaculture as there is no evidence they involved the breeding, feeding, protecting, or rearing of eels. Oral tradition in China tells of the culture of the common carp, Cyprinus carpio, as long ago as 2000–2100 BCE (around 4,000 years BP), but the earliest significant evidence lies in the literature, in the earliest monograph on fish culture called The Classic of Fish Culture, by Fan Li, written around 475 BCE (c. 2475 BP). Another ancient Chinese guide to aquaculture, wriiten by Yang Yu Jing around 460 BCE, shows that carp farming was becoming more sophisticated. The Jiahu site in China has circumstantial archeological evidence as possibly the oldest aquaculture locations, dating from 6200BCE (about 8,200 years BP), but this is speculative. When the waters subsided after river floods, some fish, mainly carp, were trapped in lakes. Early aquaculturists fed their brood using nymphs and silkworm faeces, and ate them.
Sources: en.wikipedia.org
=== Archaea === Archaea use proteases to regulate various cellular processes from cell-signaling, metabolism, secretion and protein quality control. Only two ATP-dependent proteases are found in archaea: the membrane associated LonB protease and a soluble 20S proteosome complex.
The skin consists of a thin epidermis with mucous cells and sensory cells and a fibrous dermis made of collagen and containing various cells that allow colour change. Most of the body is made of soft tissue, allowing it to squeeze through tiny gaps; even the larger species can pass through a gap little more than 2.5 cm (1 in) in diameter. Lacking skeletal support, the arms work as muscular hydrostats and feature longitudinal, transverse, and circular muscles around a central axial nerve. They can squash and stretch, coil at any place in any direction or stiffen. The interior surfaces of the arms are covered with circular, adhesive suckers. The suckers allow the octopus to secure itself in place or to handle objects. Each sucker is typically circular and bowl-like and has two distinct parts: an outer disc-shaped infundibulum and an inner cup-like acetabulum, both of which are thick muscles covered in connective tissue. A chitinous cuticle lines the outer surface. When a sucker attaches to a surface, the orifice between the two structures is sealed and the infundibulum flattens. Muscle contractions allow for attachment and detachment. Each of the eight arms senses and responds to light, allowing the octopus to control its limbs even if its head is obscured.
=== T cell epitopes === MHC class I and II epitopes can be reliably predicted by computational means alone, although not all in-silico T cell epitope prediction algorithms are equivalent in their accuracy. There are two main methods of predicting peptide-MHC binding: data-driven and structure-based. Structure based methods model the peptide-MHC structure and require great computational power. Data-driven methods have higher predictive performance than structure-based methods. Data-driven methods predict peptide-MHC binding based on peptide sequences that bind MHC molecules. By identifying T-cell epitopes, scientists can track, phenotype, and stimulate T-cells.
The company also announced in March 2020 a partnership with Welldoc to integrate G6 CGM data with BlueStar, a digital platform for diabetes management. In November 2024, Dexcom announced a "strategic partnership" and data exchange with Oura.
Sources: en.wikipedia.org
MRI for imaging anatomical structures or blood flow do not require contrast agents since the varying properties of the tissues or blood provide natural contrasts. However, for more specific types of imaging, exogenous contrast agents may be given intravenously, orally, or intra-articularly. Most contrast agents are either paramagnetic (e.g.: gadolinium, manganese, europium), and are used to shorten T1 in the tissue they accumulate in, or super-paramagnetic (SPIONs), and are used to shorten T2 and T2* in healthy tissue reducing its signal intensity (negative contrast agents). The most commonly used intravenous contrast agents are based on chelates of gadolinium, which is highly paramagnetic. In general, these agents have proved safer than the iodinated contrast agents used in X-ray radiography or CT. Anaphylactoid reactions are rare, occurring in approx. 0.03–0.1%. Of particular interest is the lower incidence of nephrotoxicity, compared with iodinated agents, when given at usual doses—this has made contrast-enhanced MRI scanning an option for patients with renal impairment, who would otherwise not be able to undergo contrast-enhanced CT. Gadolinium-based contrast reagents are typically octadentate complexes of gadolinium(III). The complex is very stable (log K > 20) so that, in use, the concentration of the un-complexed Gd3+ ions should be below the toxicity limit.
The classical, histopathological definition of amyloid is an extracellular, proteinaceous fibrillar deposit exhibiting β-sheet secondary structure and identified by apple-green birefringence when stained with congo red under polarized light. These deposits often recruit various sugars and other components such as serum amyloid P component, resulting in complex, and sometimes inhomogeneous structures. Recently this definition has come into question as some classic, amyloid species have been observed in distinctly intracellular locations. A more recent, biophysical definition is broader, including any polypeptide that polymerizes to form a cross-β structure, in vivo or in vitro, inside or outside cells. Microbiologists, biochemists, biophysicists, chemists and physicists have largely adopted this definition, leading to some conflict in the biological community over an issue of language.
Organoselenium chemistry is the science exploring the properties and reactivity of organoselenium compounds, chemical compounds containing carbon-to-selenium chemical bonds. Selenium belongs with oxygen and sulfur to the group 16 elements or chalcogens, and similarities in chemistry are to be expected. Organoselenium compounds are found at trace levels in ambient waters, soils and sediments. Selenium can exist with oxidation state −2, +2, +4, +6. Se(II) is the dominant form in organoselenium chemistry. Down the group 16 column, the bond strength becomes increasingly weaker (234 kJ/mol for the C−Se bond and 272 kJ/mol for the C−S bond) and the bond lengths longer (C−Se 198 pm, C−S 181 pm and C−O 141 pm). Consistent with the inertness of large-n s orbitals, dicoordinate selenium compounds have a bond angle of nearly 90°. Selenium compounds are more nucleophilic than the corresponding sulfur compounds and also more acidic. The pKa values of XH2 are 16 for oxygen, 7 for sulfur and 3.8 for selenium. In contrast to sulfoxides, the corresponding selenoxides are unstable in the presence of β-protons and this property is utilized in many organic reactions of selenium, notably in selenoxide oxidations and in selenoxide eliminations. The first organoselenium compound to be isolated was diethyl selenide in 1836.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
liposome Also cellule, spherule, or spherulite. 1. Any small, natural lipid globule, such as a micelle, occurring naturally in the cytoplasm; they are commonly formed by budding off from larger membrane-bound vesicles. 2. A small, spherical, artificial vesicle having at least one continuous bilayer of lipid molecules enclosing some of the medium in which it is suspended. Liposomes can be created in the laboratory by disrupting existing biological membranes and allowing complex lipids to form bilayer-bound vesicles in aqueous solution, usually with the aid of sonication. They are used experimentally as models of natural membranes and also therapeutically for the encapsulation and delivery of pharmaceutical compounds, enzymes, nutrients, nucleic acids, lipid-based nanoparticles (as in some vaccines), and many other agents between or inside of cells.
Sources: en.wikipedia.org
Reverse-phase high-performance liquid chromatography with ultraviolet detection is the most common approach. Purity is expressed as a share of total peak area at a specified wavelength. Mass spectrometry is then used to confirm molecular identity.
Solid material is often held at refrigerator or freezer temperatures, typically between minus 20 and 4 degrees Celsius. Desiccation limits moisture uptake. Solution stability is generally shorter and varies with pH and buffer composition.
Electron paramagnetic resonance is suited to copper(II) because of its unpaired electron. UV-visible spectroscopy reveals ligand-to-metal charge transfer bands. Both methods report on coordination rather than on peptide purity.
GHK denotes the unbound chain of three amino acids. GHK-Cu describes the form in which a copper(II) ion is held by that chain. The two are not interchangeable in solution, since charge, molecular weight, and reactivity differ.