If you have been reading about plasma peptide and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-09-11. Numbers and descriptions here follow the published literature rather than marketing material.
Characterizing GHK-Cu requires methods that distinguish the intact complex from free peptide and unbound copper. UV-visible absorption around 600 nm provides a rapid check for copper coordination, while circular dichroism reports on peptide secondary structure. Mass spectrometry confirms the peptide mass and can detect copper adducts under carefully controlled conditions. Electron paramagnetic resonance is particularly informative for Cu(II) because it reveals the ligand field symmetry. No single technique fully defines the complex, so laboratories combine orthogonal methods.
Stability of GHK-Cu in solution depends on pH, temperature, buffer composition, and oxygen exposure. The copper center can undergo reduction or dissociation, especially in the presence of strong metal chelators such as EDTA. Aqueous solutions are often prepared fresh or stored frozen to limit degradation. Lyophilized solid is more stable than liquid formulations, but it can absorb moisture and should be kept dry. Light exposure may also affect copper complexes, though the effect is often modest.
Purity assessment typically involves high-performance liquid chromatography for the peptide and atomic spectroscopy for copper content. The ratio of copper to peptide is a key quality parameter; a value near one indicates proper stoichiometry. Impurities can include free peptide, copper salts, and truncated sequences from synthesis. Because the complex is dynamic, sample preparation and mobile-phase conditions can shift the observed species. Reported purity values therefore depend on the analytical method and should be interpreted with that context.
Solid GHK-Cu is usually supplied as a lyophilized powder and is kept cold and dry. Moisture, light, and repeated temperature cycling shorten its useful life in the laboratory. In aqueous solution the complex undergoes slow hydrolysis of the peptide backbone and gradual loss of coordinated copper. Buffers containing strong chelators, such as EDTA, compete for the metal and strip it from the peptide. Working solutions are therefore prepared shortly before use, and leftover liquid is not returned to the stock container.
Identity and purity are established with a combination of chromatographic and spectroscopic techniques. Reversed-phase high-performance liquid chromatography separates the intact complex from peptide fragments and free copper, and the elution profile yields a purity estimate. Mass spectrometry gives the mass of the intact species and exposes degradation products. Ultraviolet-visible spectroscopy displays a broad absorption band in the visible region that is characteristic of the copper center. Nuclear magnetic resonance is less informative here, because the paramagnetic metal broadens signals and complicates spectral interpretation.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | For lyophilized solid; solutions are less stable |
| Common analytical method | RP-HPLC with UV detection | For peptide purity; copper quantified separately |
| Copper quantification | ICP-MS or atomic absorption | Determines metal content and stoichiometry |
| Aqueous stability | Hours to days at room temperature | Depends on pH, buffer, and chelators |
| Color in solution | Blue | Absorption near 600 nm indicates Cu(II) coordination |
Research interest in GHK-Cu centers on its ability to deliver copper and to influence cellular processes in laboratory models. In cell culture and animal studies, the complex has been linked to collagen synthesis, antioxidant enzyme activity, and expression of genes associated with tissue remodeling. These effects are not equivalent to proven clinical outcomes. The mechanisms proposed include copper transfer to cuproenzymes, modulation of growth factor signaling, and interactions with extracellular matrix components. How much of the observed activity depends on intact GHK-Cu versus free copper or free peptide is not fully resolved.
The compound entered scientific literature in the 1970s, when plasma factors with copper-binding activity were isolated and characterized. Later work expanded into wound healing, skin biology, and cosmetic formulation, where copper tripeptide-1 became a recognized ingredient name. Most published studies remain preclinical or small-scale, and findings are often reported in specialized dermatology or peptide journals. Regulatory treatment varies: some jurisdictions allow it as a cosmetic ingredient, while research-grade material is sold for laboratory use. Questions about optimal delivery, target tissues, and long-term effects continue to be investigated rather than settled.
Copper peptide solutions tend to resist degradation better than many free peptides, because the bound metal protects the N-terminus and reduces susceptibility to some peptidases. Backbone hydrolysis, oxidation of the histidine imidazole ring, and photochemical reactions remain the principal degradation routes. Aqueous solutions are generally most stable near neutral to mildly acidic pH, while strongly alkaline conditions accelerate hydrolysis. Light exposure is usually avoided, since both the peptide and the copper center can take part in photochemical processes. Stability data published by suppliers often describe short-term behavior rather than multi-year shelf life.
Identity and purity are commonly assessed by reversed-phase high-performance liquid chromatography, frequently paired with mass spectrometry to confirm the molecular ion. Copper content is measured separately, typically by inductively coupled plasma mass spectrometry or atomic absorption spectroscopy, because the chromatographic signal reports the peptide rather than the metal. Ultraviolet-visible spectroscopy provides a fast check on complex formation, since copper(II) peptide complexes absorb in the visible region. Elemental analysis and amino acid analysis are used less often but remain useful for reference standards. A gap between reported peptide purity and measured copper content is a recurring source of confusion.
Material described as GHK-Cu appears in several distinct markets, including cosmetic ingredients, laboratory reagents, and consumer products, and the quality expectations attached to each differ. A certificate of analysis generally reports peptide purity by chromatography, copper content, appearance, and residual solvents or counterions. Counterion identity matters, because the complex is usually supplied as an acetate or a similar salt, and the counterion contributes to the measured mass. Independent verification of sequence and metal stoichiometry is advisable when a material is used for quantitative work. Batch-to-batch variation is common and should be documented rather than assumed negligible.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide was isolated from human plasma in the early 1970s by Loren Pickart, who observed that a plasma fraction from young donors stimulated growth in cultured liver cells. The copper-bound form is abbreviated GHK-Cu, while the metal-free peptide is written simply as GHK. In the research literature the complex also appears as copper tripeptide-1 and as glycyl-histidyl-lysine copper complex.
Copper(II) binds the peptide through four nitrogen donors: the terminal amino group, the imidazole nitrogen of histidine, and two deprotonated amide nitrogens of the peptide backbone. This tetradentate arrangement gives a roughly square-planar geometry, the thermodynamically favoured form near neutral pH. Because the amide nitrogens must lose a proton before they can coordinate, complex formation is strongly pH-dependent, and the fully coordinated species dominates only above mildly acidic conditions. Electronic transitions within the copper d orbital set produce the characteristic blue to violet colour in aqueous solution.
Endogenous GHK occurs in blood plasma, saliva, and urine, and reported plasma concentrations decline with age in several studies. Researchers have proposed that the peptide acts as a copper carrier that delivers the metal to cells and to sites of injury. That transport role is a hypothesis supported by binding measurements and tissue-distribution data rather than a settled mechanism, and the peptide is generally described as a minor contributor to total plasma copper transport. Values reported in wound fluid and certain tissue extracts are higher than in circulating plasma.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
=== European Union === Use of zinc pyrithione is prohibited within cosmetic products in the European Union since December 2021. The substance was considered safe for use in rinse-off and leave-in products of different tested concentrations, but due to potential environmental toxicity consideration of the use of zinc pyrithione was made against potential alternative substance ingredients. Due to no industry submission to the regulators supporting the continued use of zinc pyrithione and/or an absence of indications that there were no suitable alternatives to the substance: the use of zinc pyrithione became automatically prohibited within cosmetic products as an intended ingredient. This was as a consequence of zinc pyrithione addition to the Cosmetic Product Regulation (EC) No 1223/2009 Annex II list.
=== 1986 === January 13: The South Yemen Civil War begins. January 24: The South Yemen Civil War ends with a brief internal conflict in the Yemeni Socialist Party. February 13: France launches Operation Epervier (Sparrowhawk) in an effort to repulse the Libyan invasion of Chad. February 25: The People Power Revolution takes place in the Philippines, overthrowing President Ferdinand Marcos. The Philippines' first female president, Corazon Aquino, was installed as president. April 15: U.S. planes bomb Libya in Operation El Dorado Canyon. April 26: Chernobyl disaster: a Soviet nuclear power plant in Ukraine explodes, resulting in the worst nuclear power plant accident in history. July 22: The Surinamese Interior War occurs. October 11–12: Reykjavik Summit: a breakthrough in nuclear arms control. October 19: The pro-Marxist interim President of Mozambique, Samora Machel, is killed when the aircraft he is travelling in crashes in South Africa. November 3: Iran–Contra affair: the Reagan administration publicly announces that it has been selling arms to Iran in exchange for hostages and illegally transferring the profits to the Contra rebels in Nicaragua.
Sources: en.wikipedia.org
==== Fairness ==== Testosterone might encourage fair behavior. For one study, subjects took part in a behavioral experiment where the distribution of a real amount of money was decided. The rules allowed both fair and unfair offers. The negotiating partner could subsequently accept or decline the offer. The fairer the offer, the less probable a refusal by the negotiating partner. If no agreement was reached, neither party earned anything. Test subjects with an artificially enhanced testosterone level generally made better, fairer offers than those who received placebos, thus reducing the risk of a rejection of their offer to a minimum. Two later studies have empirically confirmed these results. However men with high testosterone were significantly 27% less generous in an ultimatum game. This additional information could suggest, contrarily, that testosterone may encourage greed or selfishness. Fairer offers from test subjects with higher testosterone in the original study increase the likeliness of the offer being accepted by the negotiating partner, therefore decreasing the probability of both participants leaving without any money.
Alcohol (ethanol/ethyl alcohol) – GABAA receptor positive allosteric modulator Alkyl nitrites (poppers) (e.g., amyl nitrite) – nitric oxide donors, vasodilators, muscle relaxants, inhalants Cannabinoids (e.g., THC, cannabis, synthetic cannabinoids) – cannabinoid CB1 receptor agonists Dissociative hallucinogens (e.g., ketamine, methoxetamine, phencyclidine (PCP)) – ionotropic glutamate NMDA receptor antagonists Entactogens (empathogens) (e.g., MDMA (ecstasy), mephedrone, 6-APB, borax combo) – serotonin–norepinephrine–dopamine releasing agents (SNDRAs), other actions γ-Hydroxybutyric acid (GHB; oxybate) and prodrugs (e.g., GBL, 1,4-BD) – GABAB and GHB receptor agonists Phosphodiesterase PDE5 inhibitors (e.g., sildenafil, tadalafil, vardenafil, avanafil) Psychostimulants (stimulants) (e.g., amphetamine, methamphetamine, cocaine, mephedrone (4-MMC), metaphedrone (3-MMC), MDPV) – norepinephrine–dopamine releasing agents (NDRAs) and/or norepinephrine–dopamine reuptake inhibitors (NDRIs) Serotonergic psychedelics (e.g., 2C-B, 5-MeO-DiPT, 5-MeO-MiPT) – serotonin 5-HT2A receptor agonists
=== MB-003 === MB-003 is a cocktail of three humanized or human–mouse chimeric mAbs: c13C6, h13F6, and c6D8. A study published in September 2012 found that rhesus macaques infected with Ebola virus (EBOV) survived when receiving MB-003 (mixture of 3 chimeric monoclonal antibodies) one hour after infection. When treated 24 or 48 hours after infection, four of six animals survived and had little to no viremia and few, if any, clinical symptoms. MB-003 was created by scientists at the U.S. Army Medical Research Institute of Infectious Diseases, Gene Olinger, and Jamie Pettitt in collaboration with Mapp Biopharmaceutical with years of funding from US government agencies including the National Institute of Allergy and Infectious Disease, Biomedical Advanced Research and Development Authority, and the Defense Threat Reduction Agency.
Folgers is an American brand of coffee produced and sold in the United States, with additional distribution in Asia, Canada and Mexico. It forms part of the food and beverage division of the J.M. Smucker Company. Folgers roasts its coffee in New Orleans.
Sources: en.wikipedia.org
Thus these two experiments are used to build so called spin systems, that is build a list of resonances of the chemical shift of the peptide proton, the alpha protons and all the protons from each residue's sidechain. Which chemical shifts corresponds to which nuclei in the spin system is determined by the conventional correlation spectroscopy connectivities and the fact that different types of protons have characteristic chemical shifts. To connect the different spinsystems in a sequential order, the nuclear Overhauser effect spectroscopy experiment has to be used. Because this experiment transfers magnetization through space, it will show crosspeaks for all protons that are close in space regardless of whether they are in the same spin system or not. The neighbouring residues are inherently close in space, so the assignments can be made by the peaks in the NOESY with other spin systems. One important problem using homonuclear nuclear magnetic resonance is overlap between peaks. This occurs when different protons have the same or very similar chemical shifts. This problem becomes greater as the protein becomes larger, so homonuclear nuclear magnetic resonance is usually restricted to small proteins or peptides.
=== Metamorphosis and cell death === Undergoing metamorphosis requires a tremendous amount of change for the fly, such as cell death. While it is commonly believed that programmed cell death and apoptosis are the same, they are not always so. At the beginning of metamorphosis during the larvae stage, salivary gland cells of Calliphora vomitoria larvae are programmed to self-destruct. After enough feeding, the larvae come to rest and an initial protein synthesis stage occurs, culminating in the production of high amounts of protein. This occurs from day 1 to about day 8. Then, on day 9, cell death of salivary gland cells occurs. This pattern of synthesis and destruction is not to be confused with apoptosis, as no DNA degeneration is seen and cells are shown to vacuolate and swell (instead of condensing and shrinking, as in the case of apoptosis). Instead, selective expression and DNA synthesis occur during programmed cell death of salivary gland cells.
== Further reading == Havelock, H. (April 1898). "The Cossacks in the Early Seventeenth Century". English Historical Review. 13 (50): 242–260. JSTOR 547225. Longworth, Philip (1969). The Cossacks. London: Constable. Seaton, Albert (1985). The Horsemen of the Steppes: The Story of the Cossacks. London: The Bodley Head. ISBN 978-0-370-30534-9. Summerfield, Stephen (2005). Cossack Hurrah: Russian Irregular Cavalry Organisation and Uniforms during the Napoleonic Wars. Partizan Press. ISBN 978-1-85818-513-2. Summerfield, Stephen (2007). The Brazen Cross: Brazen Cross of Courage: Russian Opochenie, Partizans and Russo-German Legion during the Napoleonic Wars. Partizan Press. ISBN 978-1-85818-555-2. Ure, John (1999). The Cossacks. London: Constable. ISBN 978-0-094-77400-1. Witzenrath, Christoph (2007). Cossacks and the Russian Empire, 1598–1725: Manipulation, Rebellion and Expansion into Siberia. Routledge. ISBN 978-1-134-11749-9. "General der Flieger Hellmuth Felmy" [The Cossack Corps]. US Army Historical Division. Hailer Publishing. 2007. Archived from the original on 2009-04-15. Kondufor, Yuri (1986). A Short History of the Ukraine. Kyiv: Naukova Dumka.
Sources: en.wikipedia.org
Peptide content is usually measured by reverse-phase high-performance liquid chromatography, while copper is measured by atomic spectroscopy. Mass spectrometry can confirm the peptide identity and detect copper adducts. Combining these methods gives a more complete picture.
pH, temperature, oxygen, light, and the presence of metal chelators all influence stability. Strong chelators can strip copper from the peptide, and reducing agents can change the copper oxidation state. Lyophilized solid stored cold and dry is generally more stable than aqueous solutions.
Purity is method-dependent because different techniques detect different impurities. A peptide purity value from HPLC does not describe copper content or the amount of free peptide. Reports should specify the analytical method and the ratio of copper to peptide.
Lyophilized material is normally held at about minus twenty degrees Celsius in a sealed, desiccated vial. Dissolved samples are less durable and are prepared fresh. Repeated freeze-thaw cycles are avoided.